134086-ML650
SULT2B1 (Sulfotransferase Family, Cytosolic, 2B, Member 1, Alcohol Sulfotransferase, HSST2, Hydroxysteroid Sulfotransferase 2, ST2B1, Sulfotransferase 2B1) (MaxLight 650)
Größe
£914.00
- SKU:
- 134086-ML650
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-91 from human SULT2B1 (NP_814444) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2E5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Weitere Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. SULT2B1 (Sulfotransferase 2B1; also ST2B1b and alcohol sulfotransferase) is a 45-48kD member of the sulfotransferase 1 family of enzymes. SULT2B1 is widely expressed, being found in platelets, stratum granulosum keratinocytes, breast and prostatic epithelium, and syncytiotrophoblast cells. SULT2B1 catalyzes the sulfonation of DHEA, a precursor for sex steroids, and cholesterol, which supports stratification of the epidermis. Human SULT2B1 is 365aa in length. There are PAPS binding sites between aa70-75 and 147-155, a myristoylation motif between aa255-259, and a Pro-rich region between aa305-364 that may extend enzyme half-life. There is one 43kD splice form (ST2B1a) that shows an eight aa substitution for aa1-23. It is expressed in fetal brain and generates pregnenolone sulfate, a steroid that modulates neurotransmitters. Full-length human SULT2B1b shares only 71% aa identity with mouse SULT2B1. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDGPAEPQIPGLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFIITYPKSGTTWMIEIICLILKEGDPS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice