134070
SULT1A1 (Sulfotransferase 1A1, ST1A1 ,Aryl Sulfotransferase 1, Phenol Sulfotransferase 1, Phenol-sulfating Phenol Sulfotransferase 1, P-PST 1, Thermostable Phenol Sulfotransferase, Ts-PST, HAST1/HAST2, ST1A3, STP, STP1, OK/SW-cl.88, MGC131921, MGC5163)
Größe
£685.00
- SKU:
- 134070
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length human SULT1A1, aa1-295 (AAH00923.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Cytosolic sulfotransferases catalyze the sulfonation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. They are distinct from Golgi resident sulfotransferases by the absence of transmembrane domains and are located in the cytoplasm. SULT1A1 is one of two phenol sulfotransferases with thermostable enzyme activity. The enzyme is more specific for sulfonation on catecholamines, phenolic drugs and neurotransmitters. Because of its ability to modify diverse promutagen and procarcinogen xenobiotics, it is implicated in a range of cancers. The crystal structure of the enzyme reveals that its active site is flexible and can accommodate diverse hydrophobic substrates with varying sizes, shapes and flexibility. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice