134020-HRP

STUB1 (STIP1 Homology and U box-containing Protein 1, E3 Ubiquitin-protein Ligase CHIP, Antigen NY-CO-7, CLL-associated Antigen KW-8, Carboxy Terminus of Hsp70-interacting Protein, CHIP, PP1131, HSPABP2, NY-CO-7, SDCCAG7, UBOX1) (HRP)

Größe

£914.00

SKU:: 134020-HRP
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa204-303 from STUB1 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2E12
Format:: Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Horseradish peroxidase (HRP).
Weitere Details:: Applications: Suitable for use in Western Blot and ELISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: HDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.