UBASH3B (Ubiquitin-associated and SH3 Domain-containing Protein B, Cbl-interacting Protein p70, KIAA1959, Suppressor of T-cell Receptor Signaling 1, STS1, STS-1, T-cell Ubiquitin Ligand 2, TULA-2, Tyrosine-protein Phosphatase STS1/TULA2)

Größe

£685.00

SKU:: 134019
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa344-442 from human STS-1 (NP_116262) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3G7
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: DGVLERRPYEDQGLGETTPLTIICQPMQPLRVNSQPGPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.