133996-ML490
STK4 (Serine/Threonine-protein Kinase 4, STE20-like Kinase MST1, Mammalian STE20-like Protein Kinase 1, MST-1, Serine/Threonine-Protein Kinase Krs-2, MST1, DKFZp686A2068) (MaxLight 490)
Größe
£914.00
- SKU:
- 133996-ML490
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-40 from human STK4 (AAH05231) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1D7-8A10
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. MST-1 (Mammalian STE20-like kinase 1) is a serine/threonine kinase that has been implicated to play a role in chromatin condensation. Its C-terminal contains nuclear export signals which are released upon caspase mediated cleavage. The N-terminus portion of MST-1 then translocates to the nucleus and will promote chromatin condensation. The full length of MST-1 is localized to the cytoplasm. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEG Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice