133943
STAT6 (Signal Transducer and Activator of Transcription 6, IL-4 Stat)
Größe
£685.00
- SKU:
- 133943
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa695-804 from human STAT6 (NP_003144) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 6C10
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Upon activation by Janus kinases, Stat6 translocates to the nucleus where it regulates cytokine-induced gene expression. Stat6 is activated via phosphorylation at Tyr641 and is required for responsiveness to IL-4 and IL-13. In addition, Stat6 is activated by IFNa in B cell lines, where it forms transcriptionally active complexes with Stat2 and p48. Protein phosphatase 2A is also involved in regulation of IL-4-mediated Stat6 signaling. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice