Stabilin 1 (Stabilin-1, STAB1, STAB-1, Fasciclin, EGF-like, Laminin-type EGF-like and Link Domain-containing Scavenger Receptor 1, FEEL1, FEEL-1, FELE-1, CLEVER-1, FEX1, KIAA0246, MS-1 Antigen)

Größe

£685.00

SKU:: 133908
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa1804-1902 from human Stabilin 1 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4G9
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications have not been tested. Recommended Dilutions: Immunofluorescence:10ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: EALASDLPNLGPLRTMHGTPISFSCSRTRAGELMVGEDDARIVQRHLPFEGGLAYGIDQLLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.