133908-PE

Stabilin 1 (Stabilin-1, STAB1, STAB-1, Fasciclin, EGF-like, Laminin-type EGF-like and Link Domain-containing Scavenger Receptor 1, FEEL1, FEEL-1, FELE-1, CLEVER-1, FEX1, KIAA0246, MS-1 Antigen) (PE)

Größe

£914.00

SKU:: 133908-PE
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa1804-1902 from human Stabilin 1 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4G9
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Weitere Details:: Applications: Suitable for use in FLISA, Immunofluorescence and Western Blot. Other applications have not been tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: EALASDLPNLGPLRTMHGTPISFSCSRTRAGELMVGEDDARIVQRHLPFEGGLAYGIDQLLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQ Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.