133907
ST8SIA4 (Sialyltransferase St8Sia IV, ST8SiaIV, ST8SIA-IV, CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase, Alpha-2,8-sialyltransferase 8D, Polysialyltransferase-1, PST, PST1, Sialyltransferase 8D, SIAT8D, SIAT8-D)
Größe
£685.00
- SKU:
- 133907
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full-length recombinant protein corresponding to aa1-169 from ST8SIA4 (AAH27866) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1H5
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MRSIRKKWTICTISLLLIFYKTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSECGKEIDSHNFVIR* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice