133898-ML550

ST5 (Suppression of Tumorigenicity 5 Protein, DENN Domain-containing Protein 2B, HeLa Tumor Suppression 1, DENND2B, HTS1, MGC33090) (MaxLight 550)

Größe

£914.00

SKU:: 133898-ML550
Anwendung:: FLISA
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1038-1136 from human ST5 (NP_005409) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1A3
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Weitere Details:: MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. ST5 was identified by its ability to suppress the tumorigenicity of Hela cells in nude mice. The protein contains a C-terminal region that shares similarity with the Rab 3 family of small GTP binding proteins. This protein preferentially binds to the SH3 domain of c-Abl kinase, and acts as a regulator of MAPK1/ERK2 kinase, which may contribute to its ability to reduce the tumorigenic phenotype in cells. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VGHYSLFLTQSEKGERAFQREAFRKSVASKSIRRFLEVFMESQMFAGFIQDRELRKCRAKGLFEQRVEQYLEELPDTEQSGMNKFLRGLGNKMKFLHK* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice