133894-HRP
ST3GAL2 (SIAT4-B, ST3Gal II, ST3GalII, ST3GalA.2, SIAT4B, CMP-N-acetylneuraminate-beta-galactosamide- alpha-2,3-sialyltransferase 2, Beta-galactoside alpha-2,3-sialyltransferase 2, Alpha 2,3-ST 2, Gal-NAc6S, Gal-beta-1,3-GalNAc-alpha-2,3- sialyltransferase, Sialyltransferase 4B) (HRP)
Größe
£914.00
- SKU:
- 133894-HRP
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa28-128 from human ST3GAL2 (NP_008858) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1E12
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Weitere Details:
- The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi but can be proteolytically processed to a soluble form. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4A. [provided by RefSeq] Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1-10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: HHSMATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEV* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice