ST13 (Hsc70-interacting Protein, Progesterone Receptor-associated p48 Protein, Protein FAM10A1, Putative Tumor Suppressor ST13, Renal Carcinoma Antigen NY-REN-33, Suppression of Tumorigenicity 13 Protein, FAM10A1, HIP, SNC6, FLJ27260, MGC129952)

Größe

£685.00

SKU:: 133890
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant corresponding to aa1-59 from human ST13 (AAH15317) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2B2
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: ST13 is an adaptor protein that mediates the association of the heat shock proteins HSP70 and HSP90. This protein has been shown to be involved in the assembly process of glucocorticoid receptor, which requires the assistance of multiple molecular chaperones. The expression of this protein is reported to be downregulated in colorectal carcinoma tissue suggesting that is a candidate tumor suppressor. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLFKSFKNTHHINLHLSLCVLLLMCRVLLSRNCQCVLGLTQEQFLLDSLFDLFNLIIF* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.