133877
SSTR5 (Somatostatin Receptor Type 5, SS-5-R, SS5-R, SS5R)
Größe
£760.00
- SKU:
- 133877
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human SSTR5, aa1-364 (AAI46577.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- SSTR5 is a Somatostatin Receptor. SSTR5 and dopamine type 2 receptors interact physically through heterooligomerization to create a novel receptor with enhanced functional activity (Rocheville et al., 2000). SSTR5 has been reported to be expressed in adrenal, aorta, brain, breast, eye, heart, pancreas, prostate, skeletal muscle, small intestine, and thyroid. ESTs have been isolated from cartilage libraries. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADVQEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCANPVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice