SRD5A2 (3-oxo-5-alpha-steroid 4-dehydrogenase 2, 5 alpha-SR2, SR Type 2, Steroid 5-alpha-reductase 2, S5AR 2, Type II 5-alpha Reductase, MGC138457)

Größe

£685.00

SKU:: 133826
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa29-128 from human SRD5A2 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1F4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Converts testosterone (T) into 5-alpha-dihydrotestosterone (DHT) and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.