Eppin (Cancer/testis Antigen 71, CT71, Epididymal Protease Inhibitor, Protease Inhibitor WAP7, Serine Protease Inhibitor-like with Kunitz and WAP Domains 1, SPINLW1, WAP Four-disulfide Core Domain Protein 7, WAP7, WFDC7)

Größe

£698.00

SKU:: 133775
Reinheit:: Ascites
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa22-134 from human SPINLW1 (NP_065131) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4G3
Format:: Supplied as a liquid in ascites fluid.
Weitere Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQDNKKCCVFSCGKKCLDLKQDVCEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLNTCKNKRFP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.