SPAG4 (Sperm-associated Antigen 4 Protein, Outer Dense Fiber-associated Protein SPAG4, SUN Domain-containing Protein 4, SUN4)

Größe

£685.00

SKU:: 133740
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa221-331 from human SPAG4 (NP_003107) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3C8
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: May assist the organization and assembly of outer dense fibers (ODFs), a specific structure of the sperm tail. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AELDKLHKEVSTVRAANSERVAKLVFQRLNEDFVRKPDYALSSVGASIDLQKTSHDYADRNTAYFWNRFSFWNYARPPTVILEPHVFPGNCWAFEGDQGQVVIQLPGRVQ* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.