133618
SNCG (Gamma-synuclein, Breast Cancer-specific Gene 1 Protein, Persyn, Synoretin, SR, BCSG1, PERSYN, PRSN)
Größe
£685.00
- SKU:
- 133618
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length protein corresponding to aa1-127 of human SNCG.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- Synuclein, gamma is a 127aa protein (~14kD) which belongs to the synuclein family, which also includes alpha- and beta- synuclein. Three synucleins are located in the neuronal cytosol and enriched in presynaptic terminals, while SYN is also expressed in many other non-neuronal tissues. SYN is abnormally expressed in a high percentage of tumor tissues of diversified cancer types, including liver, esophagus, colon, gastric, lung, prostate, cervical, and breast cancer, but rarely expressed in tumor-matched nonneoplastic adjacent tissues. High levels of SYN have been identified in advanced breast carcinomas suggesting a correlation between overexpression of SYN and breast tumor development. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice