SNAPC4 (snRNA-activating Protein Complex Subunit 4, SNAPc Subunit 4, Proximal Sequence Element-binding Transcription Factor Subunit alpha, PSE-binding Factor Subunit alpha, PTF Subunit alpha, snRNA-activating Protein Complex 190kD Subunit, SNAPc 190kD Subunit, SNAP190)

Größe

£685.00

SKU:: 133613
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa53-163 from human SNAPC4 (NP_003077) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1D1
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. Binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. Recruits TBP and BRF2 to the U6 snRNA TATA box. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PADPPISEEERWGEASNDEDDPKDKTLPEDPETCLQLNMVYQEVIQEKLAEANLLLAQNREQQEELMRDLAGSKGTKVKDGKSLPPSTYMGHFMKPYFKDKVTGVGPPAN* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.