SNAPAP (SNARE-associated Protein Snapin, Biogenesis of Lysosome-related Organelles Complex 1 Subunit 7, BLOC-1 Subunit 7, Synaptosomal-associated Protein 25-binding Protein, SNAP-associated Protein, BLOC1S7, SNAP25BP, SNAPIN)

Größe

£685.00

SKU:: 133610
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa41-137 from SNAPAP (NP_036569) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3H1
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: May modulate a step between vesicle priming, fusion and calcium-dependent neurotransmitter release by potentiating the interaction of synaptotagmins with the SNAREs and the plasma-membrane-associated protein SNAP25. Its phosphorylation state influences exocytotic protein interactions and may regulate synaptic vesicle exocytosis. May also have a role in the mechanisms of SNARE-mediated membrane fusion in non-neuronal cells. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: DSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.