SMOC1 (SPARC-Related Modular Calcium-Binding Protein 1, Secreted Modular Calcium-Binding Protein 1, SMOC-1)

Größe

£685.00

SKU:: 133576
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa150-221 from human SMOC1 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 8F10
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Plays essential roles in both eye and limb development. Probale regulator of osteoblast differentiation. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: SVQNKTPVCSGSVTDKPLSQGNSGRKDDGSKPTPTMETQPVFDGDEITAPTLWIKHLVIKDSKLNNTNIRNS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.