SMC1A (Structural Maintenance of Chromosomes Protein 1A, SMC Protein 1A, SMC-1-alpha, SMC-1A, SMC1, SMC1L1, CDLS2, DXS423E, KIAA0178, Sb1.8, SB1.8, SMCB)

Größe

£685.00

SKU:: 133563
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa366-466 from SMC1L1 (NP_006297) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1B9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Applications: Suitable for use in ELISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml Optimal dilutions to be determined by the researcher. AA sequence: TLEENQVKKYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAKIKQKLREIEENQKRIEKLEEYITTSKQSLEEQKKLEGELTEEVEM* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.