133546
SMAD7 (MADH7, MADH8, Mothers Against Decapentaplegic Homolog 7, MAD Homolog 7, Mothers Against DPP Homolog 7, Mothers Against Decapentaplegic Homolog 8, MAD Homolog 8, Mothers Against DPP Homolog 8, SMAD Family Member 7, SMAD 7, hSMAD7, FLJ16482)
Größe
£685.00
- SKU:
- 133546
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa160-260 from human SMAD7 (NP_005895) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4E1
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Smad proteins, the mammalian homologs of the Drosophila Mothers against dpp (Mad), have been implicated as downstream effectors of TGFb/BMP signaling. Smad1, Smad5, and Smad8 are effectors of BMP2 and BMP4 function while Smad2 and Smad3 are involved in TGF-b and activin-mediated growth modulation. Smad4 has been shown to mediate all of the above activities through interaction with various Smad family members. Smad6 and Smad7 regulate the response to activin/TGFb signaling by interfering with TGFb-mediated phosphorylation of other Smad family members. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: CKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice