133541-HRP
SMAD5 (Mothers Against Decapentaplegic Homolog 5, Mothers Against DPP Homolog 5, MAD Homolog 5, Mad5, SMAD Family Member 5, SMAD 5, Smad5, JV5-1, MADH5, DKFZp781C1895, DKFZp781O1323) (HRP)
Größe
£914.00
- SKU:
- 133541-HRP
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa105-182 from human SMAD5 (AAH09682) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2D7
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Weitere Details:
- Smad proteins, the mammalian homologs of the Drosophila Mothers against dpp (Mad), have been implicated as downstream effectors of TGFb/BMP signaling. Smad1, Smad5, and Smad8 are effectors of BMP2 and BMP4 function while Smad2 and Smad3 are involved in TGF-b and activin-mediated growth modulation. Smad4 has been shown to mediate all of the above activities through interaction with various Smad family members. Smad6 and Smad7 regulate the response to activin/TGFb signaling by interfering with TGFb-mediated phosphorylation of other Smad family members. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KPLDICEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQPNN Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice