133538-ML550
SMAD3 (Mothers Against Decapentaplegic Homolog 3, SMAD 3, Mothers Against DPP Homolog 3, MAD Homolog 3, Mad3, hMAD-3, SMAD Family Member 3, JV15-2, hSMAD3, MADH3, DKFZp586N0721, DKFZp686J10186, HSPC193, HsT17436, MGC60396) (MaxLight 550)
Größe
£934.00
- SKU:
- 133538-ML550
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human SMAD3, aa31-141.
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Weitere Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. SMAD3, a transcriptional regulator, is activated by TGF-beta and Activin 1 receptor kinase. SMAD3 recognizes an 8 bp palindromic sequence GTCTAGAC. Upon phosphorylation at two extreme C-terminal serines, SMAD3 is translocated into the nucleus where is forms complexes other SMAD proteins, depending on the activation pathway, and regulates the transcription of target genes. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ELRLHHSFVLTGDVGRRICRLLVGLFTKGDTSSKRVHPFSPGPCFLLCDLARVGSSPKINVSPFYQNQTSTQRSCTVFVWQRCSLVGPFQVTVFTMYFHHSLRSISRFSSG Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice