SLC28A2 (Solute Carrier Family 28 Member 2, Sodium/Nucleoside Cotransporter 2, Na(+)/Nucleoside Cotransporter 2, Sodium-coupled Nucleoside Transporter 2, Concentrative Nucleoside Transporter 2, CNT 2, rCNT2, Sodium/Purine Nucleoside Co-transporter, SPNT, CNT2)

Größe

£685.00

SKU:: 133467
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-80 from SLC28A2 (NP_004203) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2D3
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: SLC28A2 regulates adenosine transport across the blood-brain barrier into the brain. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEKASGRQSIALSTVETGTVNLGLELMEKEVEPEGSKRTDAQGHSLGDGLGPSTYQRRSRWPFSKARSFCKTHARLFKK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.