133467-ML490

SLC28A2 (Solute Carrier Family 28 Member 2, Sodium/Nucleoside Cotransporter 2, Na(+)/Nucleoside Cotransporter 2, Sodium-coupled Nucleoside Transporter 2, Concentrative Nucleoside Transporter 2, CNT 2, rCNT2, Sodium/Purine Nucleoside Co-transporter, SPNT, CNT2) (MaxLight 490)

Größe

£914.00

SKU:: 133467-ML490
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-80 from SLC28A2 (NP_004203) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2D3
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
Weitere Details:: MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. SLC28A2 regulates adenosine transport across the blood-brain barrier into the brain. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEKASGRQSIALSTVETGTVNLGLELMEKEVEPEGSKRTDAQGHSLGDGLGPSTYQRRSRWPFSKARSFCKTHARLFKK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.