SLC25A25 (Calcium-binding Mitochondrial Carrier Protein SCaMC-2, Mitochondrial ATP-Mg/Pi Carrier Protein 3, Mitochondrial Ca(2+)-dependent Solute Carrier Protein 3, Small Calcium-binding Mitochondrial Carrier Protein 2, Solute Carrier Family 25 Member 25, APC3, KIAA1896, MCSC3, SCAMC2, UNQ549/PRO1106)

Größe

£685.00

SKU:: 133441
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa2-111 from human SLC25A25 (NP_443133) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4D8
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LCLCLYVPVIGEAQTEFQYFESKGLPAELKSIFKLSVFIPSQEFSTYRQWKQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.