SLC25A23 (Calcium-binding Mitochondrial Carrier Protein SCaMC-3, Mitochondrial ATP-Mg/Pi Carrier Protein 2, Mitochondrial Ca(2+)-dependent Solute Carrier Protein 2, Small Calcium-binding Mitochondrial Carrier Protein 3, Solute Carrier Family 25 Member 23, APC2, MCSC2, SCAMC3)

Größe

£685.00

SKU:: 133438
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa2-75 from human SLC25A23 (NP_077008) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3E1
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: SLC25A23 is a calcium dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDGGLDLEEFSRY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.