SLC25A18 (Mitochondrial Glutamate Carrier 2, GC-2, Glutamate/H(+) Symporter 2, Solute Carrier Family 25 Member 18, GC2)

Größe

£685.00

SKU:: 133434
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa124-185 from human SLC25A18 (NP_113669) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2F12
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: SLC25A18 belongs to the mitochondrial carrier family and contains three Solcar repeats. It is involved in the transport of glutamate across the inner mitochondrial membrane. Glutamate is co-transported with H(+). Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EMLKIQLQDAGRLAVHHQGSASAPSTSRSYTTGSASTHRRPSATLIAWELLRTQGLAGLYR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.