SLC25A13 (Calcium-binding Mitochondrial Carrier Protein Aralar2, Mitochondrial Aspartate Glutamate Carrier 2, Solute Carrier Family 25 Member 13, Citrin, ARALAR2)

Größe

£685.00

SKU:: 133431
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa2-80 from SLC25A13 (NP_055066) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4F4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Catalyzes the calcium-dependent exchange of cytoplasmic glutamate with mitochondrial aspartate across the mitochondrial inner membrane. May have a function in the urea cycle. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: AAAKVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVELLSGVVDQTKDGLISFQEFVA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.