SLC1A6 (EAAT4, Excitatory Amino Acid Transporter 4, Sodium-dependent Glutamate/Aspartate Transporter, Solute Carrier Family 1 Member 6, MGC33092, MGC43671)

Größe

£685.00

SKU:: 133416
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa500-565 from human SLC1A6 (NP_005062) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6D9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Transports L-glutamate and also L-and D-aspartate. Seems to act as a symport by cotransporting sodium. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LDRLRTMTNVLGDSIGAAVIEHLSQRELELQEAELTLPSLGKPYKSLMAQEKGASRGRGGNESAM* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.