133416-BIOTIN

SLC1A6 (EAAT4, Excitatory Amino Acid Transporter 4, Sodium-dependent Glutamate/Aspartate Transporter, Solute Carrier Family 1 Member 6, MGC33092, MGC43671) (Biotin)

Größe

£914.00

SKU:: 133416-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa500-565 from human SLC1A6 (NP_005062) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6D9
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: Transports L-glutamate and also L-and D-aspartate. Seems to act as a symport by cotransporting sodium. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LDRLRTMTNVLGDSIGAAVIEHLSQRELELQEAELTLPSLGKPYKSLMAQEKGASRGRGGNESAM* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.