133405
SLC14A2 (Solute Carrier Family 14 Member 2, Urea Transporter 2, UT2, HUT2, Urea Transporter, Kidney, UTA, UT-A2, hUT-A6, UTR)
Größe
£685.00
- SKU:
- 133405
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa40-129 from SLC14A2 (NP_009094) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3E7
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ALPLLEMPEEKDLRSSNEDSHIVKIEKLNERSKRKDDGVAHRDSAGQRCICLSKAVGYLTGDMKEYRIWLKDKHLALQFIDWVLRGTAQ* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice