SLC13A5 (Solute Carrier Family 13 Member 5, Na(+)/citrate Cotransporter, NaCT, Sodium-coupled Citrate Transporter, Sodium-dependent Citrate Transporter)

Größe

£685.00

SKU:: 133402
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa152-207 from human SLC13A5 (NP_808218) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2G4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Sandwich ELISA: The detection limit is 0.03ng/ml as a capture antibody. Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml detects SLC13A5 by immunoperoxidase staining on formalin fixed paraffin embedded human testis. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: VEAILQQMEATSAATEAGLELVDKGKAKELPGSQVIFEGPTLGQQEDQERKRLCK* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.