133402-PE

SLC13A5 (Solute Carrier Family 13 Member 5, Na(+)/citrate Cotransporter, NaCT, Sodium-coupled Citrate Transporter, Sodium-dependent Citrate Transporter) (PE)

Größe

£914.00

SKU:: 133402-PE
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa152-207 from human SLC13A5 (NP_808218) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2G4
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Weitere Details:: Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Sandwich FLISA: The detection limit is 0.03ng/ml as a capture antibody. Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml detects SLC13A5 by immunoperoxidase staining on formalin fixed paraffin embedded human testis. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: VEAILQQMEATSAATEAGLELVDKGKAKELPGSQVIFEGPTLGQQEDQERKRLCK* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.