SLC13A3 (Solute Carrier Family 13 Member 3, Na(+)/dicarboxylate Cotransporter 3, NADC3, NaDC-3, hNaDC3, Sodium-dependent High-affinity Dicarboxylate Transporter 2, SDCT2)

Größe

£685.00

SKU:: 133401
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa152-233 from human SLC13A3 (NP_073740) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3A6
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LPIANAILKSLFGQKEVRKDPSQESEENTAAVRRNGLHTVPTEMQFLASTEAKDHPGETEVPLDLPADSRKEDEYRRNIWK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.