133401-BIOTIN

SLC13A3 (Solute Carrier Family 13 Member 3, Na(+)/dicarboxylate Cotransporter 3, NADC3, NaDC-3, hNaDC3, Sodium-dependent High-affinity Dicarboxylate Transporter 2, SDCT2) (Biotin)

Größe

£914.00

SKU:: 133401-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa152-233 from human SLC13A3 (NP_073740) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3A6
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LPIANAILKSLFGQKEVRKDPSQESEENTAAVRRNGLHTVPTEMQFLASTEAKDHPGETEVPLDLPADSRKEDEYRRNIWK Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.