133397-BIOTIN

SLC11A2 (Solute Carrier Family 11 Member 2, DCT1, DMT1, NRAMP2, Natural Resistance-associated Macrophage Protein 2, Divalent Cation Transporter 1, Divalent Metal Transporter 1, FLJ37416) (Biotin)

Größe

£914.00

SKU:: 133397-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-66 from human SLC11A2 (NP_000608) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4C6
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: Solute carrier family 11, member 2 (SLCA2) also known as divalent metal ion transporter 1 (DMT1) imports Fe2+ via a proton-coupled, membrane potential dependent manner. It can also transport a variety of other divalent metal cations including Mn2+, Co2+, Cu2+, and Zn2+ but iron appears to be its most important physiological substrate. SLC11A2 has been demonstrated on the apical membrane of duodenal enterocytes, transferrin cycle endosomes in erythroid precursors, hepatocytes where it has been postulated to be involved in non-transferrin-bound iron uptake, and placenta where it has been implicated in transfer of iron from mother to fetus. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice