SIN3B (Paired Amphipathic Helix Protein Sin3b, Histone Deacetylase Complex Subunit Sin3b, KIAA0700, Transcriptional Corepressor Sin3b)

Größe

£685.00

SKU:: 133353
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1063-1161 from SIN3B (NP_056075) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2C11
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: ELISA: 3 ng/ml Optimal dilutions to be determined by the researcher. AA Sequence: HKMVFIVNSEDYMYRRGTLCRAKQVQPLVLLRHHQHFEEWHSRWLEDNVTVEAASLVQDWLMGEEDEDMVPCKTLCETVHVHGLPVTRYRVQYSRRPA* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.