133350-BIOTIN
SIM2 (Single-minded Homolog 2, Class E Basic Helix-loop-helix Protein 15, bHLHe15, BHLHE15, MGC119447) (Biotin)
Größe
£914.00
- SKU:
- 133350-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa426-526 from human SIM2 (NP_005060) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3E6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- Single-minded homolog 2 is a transcription factor that may be a master gene of CNS development in cooperation with Arnt. It may have pleiotropic effects in the tisues expressed during development. Efficient DNA binding requires dimerisation with another bHLH protein. It forms a heterodimer with ARNT. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ESSDLLYTPSYSLPFSYHYGHFPLDSHVFSSKKPMLPAKFGQPQGSPCEVARFFLSTLPASGECQWHYANPLVPSSSSPAKNPPEPPANTARHSLVPSYE* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice