Siglec 6 (Sialic Acid binding Ig-like Lectin 6, Siglec 6, Obesity-binding Protein 1, OB-BP1, CD33 Antigen-like 1, CDw327, CD327, CD33L, CD33L1, OBBP1)

Größe

£685.00

SKU:: 133345
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa371-453 from human Siglec 6 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2G6
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: SIGLEC6 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells by binding to alpha2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. SIGLEC6, which interacts with LEP, is expressed at high levels in placenta (cyto-and syncytiotrophoblastic cells) and at lower levels in spleen, peripheral blood leukocytes (predominantly B-cells) and small intestine. It contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in downmodulation of cellular responses. The phosphorylated ITIM motif binds to the SH2 domain of PTPN6/SHP-1. The gene for SIGLEC6 belongs to the immunoglobulin superfamily. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications have not been tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice