133345-ML550
Siglec 6 (Sialic Acid binding Ig-like Lectin 6, Siglec 6, Obesity-binding Protein 1, OB-BP1, CD33 Antigen-like 1, CDw327, CD327, CD33L, CD33L1, OBBP1) (MaxLight 550)
Größe
£914.00
- SKU:
- 133345-ML550
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa371-453 from human Siglec 6 with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2G6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Weitere Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. SIGLEC6 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells by binding to alpha2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. SIGLEC6, which interacts with LEP, is expressed at high levels in placenta (cyto-and syncytiotrophoblastic cells) and at lower levels in spleen, peripheral blood leukocytes (predominantly B-cells) and small intestine. It contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in downmodulation of cellular responses. The phosphorylated ITIM motif binds to the SH2 domain of PTPN6/SHP-1. The gene for SIGLEC6 belongs to the immunoglobulin superfamily. Applications: Suitable for use in FLISA, Western Blot and Immunoprecipitation. Other applications have not been tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice