133341
Siglec 10 (Sialic Acid-binding Ig-like Lectin 10, Siglec like Protein 2, SLG2, UNQ477, PRO940)
Größe
£685.00
- SKU:
- 133341
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa589-697 from human SIGLEC10 (NP_149121) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1D11
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- Siglecs (sialic acid binding Ig-like lectins) are Itype lectins that belong to the immunoglobulin superfamily. They are characterized by a V-type-Iglike domain which mediates sialic acid binding, followed by varying numbers of C2-type Iglike domains. Mouse Siglec-G, the apparent ortholog of human Siglec-10, is a 110-120kD, 688 amino acid (aa) type I transmembrane protein mainly expressed on mouse B1-type B cells. It controls B1 cell survival, selection, expansion and calcium signaling by negatively regulating B cell receptor signals. A potentially secreted 269aa variant diverges after the first two Ig-like domains. Mouse Siglec-G shares ~63% aa sequence identity with human Siglec-10 within the extracellular domain. pplications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SRHSTILDYINVVPTAGPLAQKRNQKATPNSPRTPLPPGAPSPESKKNQKKQYQLPSFPEPKSSTQAPESQESQEELHYATLNFPGVRPRPEARMPKGTQADYAEVKF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice