PUF60 (Poly(U)-binding-splicing Factor PUF60, 60kD Poly(U)-binding-splicing Factor, FUSE-binding Protein-interacting Repressor, FBP-interacting Repressor, FIR, Ro-binding Protein 1, RoBP1, ROBPI, Siah-binding Protein 1, SIAHBP1, Siah-BP1)

Größe

£685.00

SKU:: 133337
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa114-224 from SIAHBP1 (NP_055096) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3H1
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNRIYVASVHQDLSDD* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.