SHOX2 (Short Stature Homeobox Protein 2, Paired-related Homeobox Protein SHOT, Homeobox Protein Og12X, OG12X, SHOT)

Größe

£685.00

SKU:: 133330
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa117-205 from human SHOX2 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1D1
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: May be a growth regulator and have a role in specifying neural systems involved in processing somatosensory information, as well as in face and body structure formation. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SPELKDRKDDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHK* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.