133324-BIOTIN

SHIP2 (Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2, SH2 Domain-containing Inositol-5'-phosphatase 2, SH2 Domain-containing Inositol Phosphatase 2, SHIP-2, Inositol Polyphosphate Phosphatase-like Protein 1, INPPL-1, Protein 51C, INPPL1) (Biotin)

Größe

£914.00

SKU:: 133324-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1159-1258 from human INPPL1 (NP_001558) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3E6
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: SHIP2 (inositol polyphosphate-5 phosphatase-like 1), contains a phosphatase domain and an SH2 (src-homology domain 2) motif. SHIP2 iswidely expressed in fibroblast and nonhematopoietic tumor cell lines. Tyrosine phosphorylation of SHIP2 occurrs in response to treatment of cells with EGF, platelet-derived growth factor (PDGF), nerve growth factor (NGF), insulin-like growth factor-1 (IGF1), or insulin. EGF and PDGF induces transient tyrosine phosphorylation of SHIP2, while treatment of cells with NGF, IGF1, or insulin results in prolonged tyrosine phosphorylation of SHIP2, indicaating that SHIP2 may play a significant role in regulation of phosphatidylinositol 3-prime-kinase signaling by growth factors and insulin. Some animal models indicate that SHIP2 is a potent negative regulator of insulin signaling and insulin sensitivity in vivo, while others suggest that SHIP2 mediates obesity resistance but not changes in glucose and insulin homeostasis. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PSDYGRPLSFPPPRIRESIQEDLAEEAPCLQGGRASGLGEAGMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice