SHC2 (SHC-transforming Protein 2, Src Homology 2 Domain-containing-transforming Protein C2, SH2 Domain Protein C2, Protein Sck, SHCB, SCK)

Größe

£685.00

SKU:: 133316
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa718-830 from SHC2 (XP_375550) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4A4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: SHC2 is a signaling adapter that couples activated growth factor receptors to signaling pathway in neurons. It is involved in the signal transduction pathways of neurotrophin-activated Trk receptors in cortical neurons. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LALTQPCALTALDQGPSPSLRDACSLPWDVGSTGTAPPGDGYVQADARGPPDHEEHLYVNTQGLDAPEPEDSPKKDLFDMRPFEDALKLHECSVAAGVTAAPLPLEDQWPSP* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.