SH3MD2 (SH3RF1, Putative E3 Ubiquitin-protein Ligase SH3RF1, SH3 Domain-containing RING Finger Protein 1, Plenty of SH3s, Protein POSH, SH3 Multiple Domains Protein 2, RING Finger Protein 142, KIAA1494, POSH, RNF142)

Größe

£685.00

SKU:: 133311
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa790-889 from human SH3MD2 (NP_065921) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3H3
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: This gene encodes a protein containing an N-terminus RING-finger, four SH3 domains, and a region implicated in binding of the Rho GTPase Rac. Via the RING-finger, the encoded protein has been shown to function as an ubiquitin-protein ligase involved in protein sorting at the trans-Golgi network. The encoded protein may also act as a scaffold for the c-Jun N-terminal kinase signaling pathway, facilitating the formation of a functional signaling module. [provided by RefSeq] Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LAQDAFHRKASSLDSAVPIAPPPRQACSSLGPVLNESRPVVCERHRVVVSYPPQSEAELELKEGDIVFVHKKREDGWFKGTLQRNGKTGLFPGSFVENI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.