133291-ML550
SH2D3A (SH2 domain containing 3A, Novel SH2-containing Protein 1, NSP1, SH2 Domain-containing Protein 3A, UNQ175/PRO201) (MaxLight 550)
Größe
£914.00
- SKU:
- 133291-ML550
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa460-575 from SH2D3A (NP_005481) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3B11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Weitere Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. NSP1 is a cytoplasmic signaling intermediate that functions as an adaptor or scaffolding protein to integrate growth factor receptor and integrin signals. The protein contain an N-terminal SH2 domain, a central proline:serine-rich region, and a C-terminal sequence. The protein is phosphorylated in response to insulin and EGF (and insulin-like growth factor I and heregulin) indicating that NSP1 is a common target for a variety of growth factor receptors. The protein is thus involved in a process by which receptor tyrosine kinase and integrin receptors control the c-Jun N-terminal kinase:stress-activated protein kinase pathway. Protein expression is usually restricted to tissues with secretory epithelial cells. The gene encoding for human NSP1 is localized in the chromosomal region 19p13.3. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GAGPCDPGEVALPHVAPMVRLLEGEEVAGPLDESCERLLRTLHGARHMVRDAPKFRKVAAQRLRGFRPNPELREALTTGFVRRLLWGSRGAGAPRAERFEKFQRVLGVLSQRLEPD Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice