133291-BIOTIN
SH2D3A (SH2 domain containing 3A, Novel SH2-containing Protein 1, NSP1, SH2 Domain-containing Protein 3A, UNQ175/PRO201) (Biotin)
Größe
£914.00
- SKU:
- 133291-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa460-575 from SH2D3A (NP_005481) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3B11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- NSP1 is a cytoplasmic signaling intermediate that functions as an adaptor or scaffolding protein to integrate growth factor receptor and integrin signals. The protein contain an N-terminal SH2 domain, a central proline:serine-rich region, and a C-terminal sequence. The protein is phosphorylated in response to insulin and EGF (and insulin-like growth factor I and heregulin) indicating that NSP1 is a common target for a variety of growth factor receptors. The protein is thus involved in a process by which receptor tyrosine kinase and integrin receptors control the c-Jun N-terminal kinase:stress-activated protein kinase pathway. Protein expression is usually restricted to tissues with secretory epithelial cells. The gene encoding for human NSP1 is localized in the chromosomal region 19p13.3. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GAGPCDPGEVALPHVAPMVRLLEGEEVAGPLDESCERLLRTLHGARHMVRDAPKFRKVAAQRLRGFRPNPELREALTTGFVRRLLWGSRGAGAPRAERFEKFQRVLGVLSQRLEPD Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice